PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.003G180100.3
Common NameB456_003G180100, LOC105789333
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ARR-B
Protein Properties Length: 538aa    MW: 59969.2 Da    PI: 5.5761
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.003G180100.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.18.1e-28301354155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k +++WtpeLH++Fv+av+qL G+++A+P++ilelm+v+gLt+++v+SHLQkYR+
  Gorai.003G180100.3 301 KSKVDWTPELHKKFVQAVDQL-GIDQAIPSRILELMEVEGLTRHNVASHLQKYRM 354
                         6799*****************.********************************8 PP

2Response_reg21.51.1e-08201261109
                         EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHH CS
        Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalea 89 
                         +l+ d + + ++ l++ le  +y +v ++ d  ea+  +  +   +++ ++ ++  + +G+  +k +++++ +lp i+ +     +++ ++
  Gorai.003G180100.3  20 ILLLDGDTNSANELKSKLEAMDY-IVYAFHDENEAISAVSSRPesFHVAIVEVSTDNNNGS--FKFLETAK-DLPTIMTSNIHCISTMMKC 106
                         6788888899999999*******.***************666666*************997..67777766.999*99999889******* PP

                         HHTTESEEEESS--HHHHHH CS
        Response_reg  90 lkaGakdflsKpfdpeelvk 109
                         + +Ga +fl Kp ++++l++
  Gorai.003G180100.3 107 IARGAVEFLKKPLSEDKLRN 126
                         *****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23001.3E-1416150No hitNo description
SuperFamilySSF521721.85E-1316135IPR011006CheY-like superfamily
PROSITE profilePS5011018.27319132IPR001789Signal transduction response regulator, receiver domain
PfamPF000729.5E-620127IPR001789Signal transduction response regulator, receiver domain
CDDcd001568.96E-621131No hitNo description
PROSITE profilePS5129414.802298357IPR017930Myb domain
SuperFamilySSF466891.34E-18299357IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-27299357IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-25301355IPR006447Myb domain, plants
PfamPF002492.0E-7304353IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MVCTANDLST WKDFPKGLKI LLLDGDTNSA NELKSKLEAM DYIVYAFHDE NEAISAVSSR  60
PESFHVAIVE VSTDNNNGSF KFLETAKDLP TIMTSNIHCI STMMKCIARG AVEFLKKPLS  120
EDKLRNIWQH VVHKAFNTGG NDLTESLKPV KESVVSMLQQ QPENLKPKNE DSETTEDASM  180
IHENDSEPPA GNDKYPAPST PQLEQGGRLL DDRDCQDHTH CSIEKESGDQ DGETESVETT  240
GGNTTATGGQ PRGPSETNVK EEDDSVDGTM GESPQNRVDS KGSDVVAEKP SSCPDKANRK  300
KSKVDWTPEL HKKFVQAVDQ LGIDQAIPSR ILELMEVEGL TRHNVASHLQ KYRMQRRHIL  360
PKDDDRRWLQ RPQTQRICNY PHKPIMAFPP YNHVPVGPVY PMWRAPSHPP TIQMWGTQGY  420
PPWQPTESWH WKPYPGVQAD AWGCPVMPPP QGYFSTFPQN ASGFQPCNVD KRNGMPQTLA  480
EHHPEEEVID KMVKEAINKP GLPLPLGLKP PSTDSVLAEL YRQGISTVPP HINASDR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A5e-17299359363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX5816581e-122JX581658.1 Gossypium hirsutum clone NBRI_GE14330 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012472126.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
RefseqXP_012472127.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
SwissprotQ6LA431e-147APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A0D2QMP90.0A0A0D2QMP9_G
STRINGVIT_02s0012g00570.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-147ARR-B family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]